PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00604-abinit-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family G2-like
Protein Properties Length: 392aa    MW: 43356.6 Da    PI: 6.5251
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00604-abinit-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.8e-33248303156
                                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                                           k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  augustus_masked-scaffold00604-abinit-gene-0.7-mRNA-1 248 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 303
                                                           79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.1E-18245306IPR009057Homeodomain-like
PROSITE profilePS5129414.115245305IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-29246306IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-27248303IPR006447Myb domain, plants
PfamPF002496.0E-8250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGSVPPELSL DFAPSFVPKT ITDFLREVSM IGSVSERALK LDDFVKRLEE EMGKIDAFKR  60
ELPLCMILLN DAISVLKESM QCTVPNEVQP VLEEFIPLKK DCDQNEENTK EKDYKDKKNW  120
MSSVQLWNTE DFSSTDCTKS NPKLDTKKSE EEGILGSEDP FQSCRNRNGG RAFMPFKAYP  180
GFPVARKEEK EELPVHGLSL LTPGIKNPRE ESGSNGLRTS CGKSVSSSAP NAIIRSGAQQ  240
SQQQTARKQR RCWSPELHRR FVNALQQLGG SQVATPKQIR ELMQVDGLTN DEVKSHLQKY  300
RLHTRRLPNS TAAAPANQSV VVLGSLWMQD QYGDSSKASS SQSGSPQGPL HLAGNTGGTS  360
TTGGDSMEDD EDAKSEGYSW KSHTQKPGKA DV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284970.20.0PREDICTED: uncharacterized protein LOC100267475 isoform X2
TrEMBLA5BS050.0A5BS05_VITVI; Putative uncharacterized protein
STRINGVIT_03s0063g01060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-59G2-like family protein